Skip to content
  • New In
    View All ClothingShoes & BootsAccessories Maternity PetitePlus SizeTall Shop New In >
  • Clothing
    View All ClothingActivewearBlouses & ShirtsDenimDressesAll The FrillsJackets & CoatsJeansKnitwearMatching Sets & Co-ordsNightwear & LoungewearPlaysuits & JumpsuitsShortsSkirtsSwimwear & BeachwearTops & T-ShirtsTrousers & LeggingsTunicsMaternity ClothingPetite ClothingPlus Size ClothingTall ClothingCasual WearEco CollectionGoing Out & PartywearOccasionwearWorkwearShop Nightwear & Loungewear >
  • Dresses
    View All DressesBodycon DressesLace DressesMaxi DressesMidi DressesPencil DressesShift DressesShirt DressesSwing DressesMaternity DressesPetite DressesPlus Size DressesTall DressesGoing Out & Party DressesOccasion DressesWedding DressesWorkwear DressesShop All Dresses >
  • Shoes
    BootsFlat SandalsFlat ShoesHeelsMulesPumps & LoafersSandalsTrainersView All ShoesWide Fit ShoesNew In ShoesOccasion ShoesWork ShoesShop Boots. >
  • Accessories
    ClutchCross BodyPursesShoulderToteView AllBraceletsEarringsNecklacesRingsView AllBeltsFace CoveringsHair AccessoriesHatsHealth & BeautyLifestyleScarves SocksSunglassesTights View allShop Face Coverings >
  • Sale
    View All SaleCoats & JacketsDressesJeansKnitwearShoes & BootsTopsTrousers & LeggingsMaternity ClothingPetite ClothingPlus Size ClothingTall ClothingShop Sale
  1. Home
  2. Sale
  3. View All Sale
Free delivery

SALE

Update your wardrobe for less with Dorothy Perkins Sale and offers. From essential fashion pieces to on-trend looks, you'll find the best deals right here. But hurry, savings are on selected lines and they won't be around for long.
Filter
CategoryView All Sale
Brand
chi chiXdorothy perkinsXpiecesX
Top Style
t-shirtX
Size
xlX46X
Size
Shoe Size
36384042
Fit
main collectionmaternitypetiteplus sizetall
Top Style
Sleeve Length
3/4 length sleevelong sleeveshort sleevesleeveless
Colour
blackbluebrowncreamgoldgreengreypinkredsilverwhiteyellow
Brand
Rating
Price
6,00 €20,00 €
40 results
**DP Curve Silver Sequin Top as part of an outfit

**DP Curve Silver Sequin Top

42,00 € 14,00 €
See More
4 out of 5 stars4 out of 5 stars4 out of 5 stars4 out of 5 stars4 out of 5 stars
Gold Animal Shoulder Pad T-Shirt as part of an outfit

Gold Animal Shoulder Pad T-Shirt

32,00 € 10,00 €
**DP Maternity Black Spot Print Top

**DP Maternity Black Spot Print Top

25,00 € 15,00 €
Silver Ruched Sleeve Mesh Top as part of an outfit

Silver Ruched Sleeve Mesh Top

30,00 € 10,00 €
5 out of 5 stars5 out of 5 stars5 out of 5 stars5 out of 5 stars5 out of 5 stars
Black Puff Sleeve Organic Cotton Top as part of an outfit

Black Puff Sleeve Organic Cotton Top

14,00 € 6,50 €
See More
Black Sequin Embellished Sleeve T-Shirt as part of an outfit

Black Sequin Embellished Sleeve T-Shirt

25,00 € 10,00 €
Black Ruched Sleeve Velvet T-Shirt as part of an outfit

Black Ruched Sleeve Velvet T-Shirt

25,00 € 10,00 €
See More
Black Sequin T-Shirt as part of an outfit

Black Sequin T-Shirt

42,00 € 12,00 €
**DP Tall Black Mesh Top as part of an outfit

**DP Tall Black Mesh Top

27,00 € 16,00 €
See More
**DP Maternity 'Baby It's Cold Outside' Motif T Shirt as part of an outfit

**DP Maternity 'Baby It's Cold Outside' Motif T Shirt

25,00 € 10,00 €
See More
DP Petite Black Mesh Top as part of an outfit

DP Petite Black Mesh Top

27,00 € 14,00 €
1 out of 5 stars1 out of 5 stars1 out of 5 stars1 out of 5 stars1 out of 5 stars
**DP Maternity Grey Christmas T-Shirt as part of an outfit

**DP Maternity Grey Christmas T-Shirt

25,00 € 11,00 €
See More
**DP Curve Grey Christmas T-Shirt as part of an outfit

**DP Curve Grey Christmas T-Shirt

25,00 € 10,00 €
See More
Burgundy Ruched Sleeve Velvet T-Shirt as part of an outfit

Burgundy Ruched Sleeve Velvet T-Shirt

25,00 € 14,00 €
See More
Ivory Floral Organza T-Shirt as part of an outfit

Ivory Floral Organza T-Shirt

35,00 € 11,00 €
5 out of 5 stars5 out of 5 stars5 out of 5 stars5 out of 5 stars5 out of 5 stars
Khaki Puff Sleeve Soft Touch Top With Recycled Polyester as part of an outfit

Khaki Puff Sleeve Soft Touch Top With Recycled Polyester

27,00 € 20,00 €
See More
**DP Maternity Black Metallic Mesh Long Sleeve Top as part of an outfit

**DP Maternity Black Metallic Mesh Long Sleeve Top

30,00 € 10,00 €
See More
Grey Marl Diamante Trim Top With Recycled Polyester as part of an outfit

Grey Marl Diamante Trim Top With Recycled Polyester

27,00 € 14,00 €
See More
**DP Maternity Grey Brushed Nursing Wrap Top as part of an outfit

**DP Maternity Grey Brushed Nursing Wrap Top

27,00 € 14,00 €
Grey Soft Touch Wrap Top as part of an outfit

Grey Soft Touch Wrap Top

25,00 € 8,00 €
See More
Beige Soft Touch Wrap Top as part of an outfit

Beige Soft Touch Wrap Top

25,00 € 11,00 €
See More
Pink Soft Touch Wrap Top as part of an outfit

Pink Soft Touch Wrap Top

25,00 € 8,00 €
See More
**DP Maternity Navy Jersey Top

**DP Maternity Navy Jersey Top

22,00 € 10,00 €
See More
**DP Maternity White Jersey Top

**DP Maternity White Jersey Top

22,00 € 10,00 €
See More
PreviousNext

Shopping With Us

Delivery & returns
Student discount
My account

How Can We Help?

FAQs
Contact us

Good to Know

Our story
Terms & conditions
Privacy & cookies
Fashion Footprint
Manage Cookies

More...

Responsibilities
Modern slavery act
Accessibility

My bag

Your shopping bag is empty.

Country preferences

You are viewing the website for Europe. Would you like to view the website for United States instead?

NOTE: If you choose to be redirected, you will be taken to the home page.

Content is loading, please wait.

Loading